Lineage for d1vknc1 (1vkn C:1-144,C:308-339)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 478128Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (1 species)
  7. 478129Species Thermotoga maritima [TaxId:243274] [110424] (1 PDB entry)
  8. 478132Domain d1vknc1: 1vkn C:1-144,C:308-339 [108680]
    Other proteins in same PDB: d1vkna2, d1vknb2, d1vknc2, d1vknd2

Details for d1vknc1

PDB Entry: 1vkn (more details), 1.8 Å

PDB Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution

SCOP Domain Sequences for d1vknc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vknc1 c.2.1.3 (C:1-144,C:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima}
miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp
ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni
krvyglpelhreeiknaqvvgnpgXlvkgasgqavqnmnimfgldetkgleftpiyp

SCOP Domain Coordinates for d1vknc1:

Click to download the PDB-style file with coordinates for d1vknc1.
(The format of our PDB-style files is described here.)

Timeline for d1vknc1: