Lineage for d1vkja_ (1vkj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474654Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2474687Protein Heparan sulfate 3-O-sulfotransferase [102354] (1 species)
  7. 2474688Species Mouse (Mus musculus) [TaxId:10090] [102355] (2 PDB entries)
    Uniprot O35310 48-311
  8. 2474692Domain d1vkja_: 1vkj A: [108666]
    complexed with a3p, so4

Details for d1vkja_

PDB Entry: 1vkj (more details), 2.5 Å

PDB Description: crystal structure of heparan sulfate 3-o-sulfotransferase isoform 1 in the presence of pap
PDB Compounds: (A:) heparan sulfate (glucosamine) 3-O-sulfotransferase 1

SCOPe Domain Sequences for d1vkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]}
stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
hepnkkffklvgrtfdwh

SCOPe Domain Coordinates for d1vkja_:

Click to download the PDB-style file with coordinates for d1vkja_.
(The format of our PDB-style files is described here.)

Timeline for d1vkja_: