SCOP 1.73: Domain d1vkef_: 1vke F:

Lineage for d1vkef_ (1vke F:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.2: CMD-like [101468] (2 proteins)
   Pfam PF02627; hexamer of single-domain subunits

6. Protein Hypothetical protein TM1620 [101469] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries)

8. Domain d1vkef_: 1vke F: [108655]
   Structural genomics target
   complexed with mpd, unl

Details for d1vkef_

PDB Entry: 1vke, 1.56 Å

PDB Description: Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (TM1620) from Thermotoga maritima at 1.56 A resolution

PDB Compounds: (F:) carboxymuconolactone decarboxylase family protein

SCOP Domain Sequences for d1vkef_:

Sequence; same for both SEQRES and ATOM records:

>d1vkef_ a.152.1.2 (F:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
rgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasdee
ifealdialvvggsiviphlrravgfleelremekng

Timeline for d1vkef_:

• d1vkef_ first appeared in SCOP 1.69
  
• d1vkef_ appears in SCOP 1.71
  
• d1vkef_ appears in SCOP 1.75
  
• d1vkef_ appears in the current release, SCOPe 2.08