Lineage for d1vjya_ (1vjy A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612421Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 612422Species Human (Homo sapiens) [TaxId:9606] [56145] (4 PDB entries)
  8. 612423Domain d1vjya_: 1vjy A: [108633]
    complexed with 460

Details for d1vjya_

PDB Entry: 1vjy (more details), 2 Å

PDB Description: Crystal Structure of a Naphthyridine Inhibitor of Human TGF-beta Type I Receptor

SCOP Domain Sequences for d1vjya_:

Sequence, based on SEQRES records: (download)

>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens)}
iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkryma
pevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsvee
mrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqeg
ikm

Sequence, based on observed residues (ATOM records): (download)

>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens)}
iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidirvgtkrymapevl
ddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkv
vceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqegikm

SCOP Domain Coordinates for d1vjya_:

Click to download the PDB-style file with coordinates for d1vjya_.
(The format of our PDB-style files is described here.)

Timeline for d1vjya_: