SCOPe 2.06: Domain d1vgia_: 1vgi A:

Lineage for d1vgia_ (1vgi A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
   Uniprot P06762 11-222

8. Domain d1vgia_: 1vgi A: [108622]
   complexed with fmt, hem, xe

Details for d1vgia_

PDB Entry: 1vgi, 1.9 Å

PDB Description: Crystal structure of xenon bound rat heme-heme oxygenase-1 complex

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1vgia_:

Sequence; same for both SEQRES and ATOM records:

>d1vgia_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

Timeline for d1vgia_:

• d1vgia_ first appeared in SCOP 1.69
  
• d1vgia_ appears in SCOPe 2.05
  
• d1vgia_ appears in SCOPe 2.07
  
• d1vgia_ appears in the current release, SCOPe 2.08