Lineage for d1vg9h_ (1vg9 H:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582195Protein Rab7 [110540] (1 species)
  7. 582196Species Rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries)
  8. 582206Domain d1vg9h_: 1vg9 H: [108621]
    Other proteins in same PDB: d1vg9a1, d1vg9a2, d1vg9c1, d1vg9c2, d1vg9e1, d1vg9e2, d1vg9g1, d1vg9g2
    complexed with gdp, k, mg, p33; mutant

Details for d1vg9h_

PDB Entry: 1vg9 (more details), 2.5 Å

PDB Description: the crystal structures of the rep-1 protein in complex with c- terminally truncated rab7 protein

SCOP Domain Sequences for d1vg9h_:

Sequence, based on SEQRES records: (download)

>d1vg9h_ c.37.1.8 (H:) Rab7 {Rat (Rattus norvegicus)}
kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
kidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqeteve

Sequence, based on observed residues (ATOM records): (download)

>d1vg9h_ c.37.1.8 (H:) Rab7 {Rat (Rattus norvegicus)}
kvllkviilgdsgvgktslmnqyvnkkfsnqyigadfltkevmvddrlvtmqiwdtagqe
rfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnkid
lenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqeteve

SCOP Domain Coordinates for d1vg9h_:

Click to download the PDB-style file with coordinates for d1vg9h_.
(The format of our PDB-style files is described here.)

Timeline for d1vg9h_: