| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Rab7 [110540] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries) |
| Domain d1vg8d_: 1vg8 D: [108609] complexed with gnp, mg |
PDB Entry: 1vg8 (more details), 1.7 Å
SCOP Domain Sequences for d1vg8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vg8d_ c.37.1.8 (D:) Rab7 {Rat (Rattus norvegicus)}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
pepi
Timeline for d1vg8d_: