Lineage for d1vg8b_ (1vg8 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582195Protein Rab7 [110540] (1 species)
  7. 582196Species Rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries)
  8. 582198Domain d1vg8b_: 1vg8 B: [108607]

Details for d1vg8b_

PDB Entry: 1vg8 (more details), 1.7 Å

PDB Description: gppnhp-bound rab7

SCOP Domain Sequences for d1vg8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg8b_ c.37.1.8 (B:) Rab7 {Rat (Rattus norvegicus)}
kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
kidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyn

SCOP Domain Coordinates for d1vg8b_:

Click to download the PDB-style file with coordinates for d1vg8b_.
(The format of our PDB-style files is described here.)

Timeline for d1vg8b_: