SCOPe 2.05: Domain d1vg0b_: 1vg0 B:

Lineage for d1vg0b_ (1vg0 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab7 [110540] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries)
   Uniprot P09527

8. Domain d1vg0b_: 1vg0 B: [108598]
   Other proteins in same PDB: d1vg0a1, d1vg0a2
   complexed with cl, gdp, ger, mg, pg4

Details for d1vg0b_

PDB Entry: 1vg0, 2.2 Å

PDB Description: the crystal structures of the rep-1 protein in complex with monoprenylated rab7 protein

PDB Compounds: (B:) Ras-related protein Rab-7

SCOPe Domain Sequences for d1vg0b_:

Sequence, based on SEQRES records:

>d1vg0b_ c.37.1.8 (B:) Rab7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
kidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyne
fpepikl

Sequence, based on observed residues (ATOM records):

>d1vg0b_ c.37.1.8 (B:) Rab7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kvllkviilgdsgvgktslmnqyvnkkfsnigadfltkevmvddrlvtmqiwdtagqerf
qslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnkidle
nrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynefpepi
kl

Timeline for d1vg0b_:

• d1vg0b_ first appeared in SCOP 1.69
  
• d1vg0b_ appears in SCOPe 2.04
  
• d1vg0b_ appears in SCOPe 2.06
  
• d1vg0b_ appears in the current release, SCOPe 2.08