Lineage for d1vftb1 (1vft B:1005-1012,B:1250-1384)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1548097Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 1548098Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 1548099Protein Alanine racemase [50623] (3 species)
  7. 1548119Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries)
    Uniprot Q65YW7
  8. 1548124Domain d1vftb1: 1vft B:1005-1012,B:1250-1384 [108590]
    Other proteins in same PDB: d1vfta2, d1vftb2
    complexed with cl, dcs

Details for d1vftb1

PDB Entry: 1vft (more details), 2.3 Å

PDB Description: Crystal structure of L-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae
PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d1vftb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vftb1 b.49.2.2 (B:1005-1012,B:1250-1384) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}
ptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr
gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia
yeivtriggrvprvylgglehhhh

SCOPe Domain Coordinates for d1vftb1:

Click to download the PDB-style file with coordinates for d1vftb1.
(The format of our PDB-style files is described here.)

Timeline for d1vftb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vftb2