Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.2: Alanine racemase [88682] (1 protein) |
Protein Alanine racemase [50623] (3 species) |
Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries) Uniprot Q65YW7 |
Domain d1vftb1: 1vft B:1005-1012,B:1250-1384 [108590] Other proteins in same PDB: d1vfta2, d1vftb2 complexed with cl, dcs |
PDB Entry: 1vft (more details), 2.3 Å
SCOPe Domain Sequences for d1vftb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vftb1 b.49.2.2 (B:1005-1012,B:1250-1384) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]} ptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasgr gpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahtia yeivtriggrvprvylgglehhhh
Timeline for d1vftb1: