![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
![]() | Protein Alanine racemase [51421] (3 species) |
![]() | Species Streptomyces lavendulae [TaxId:1914] [110346] (3 PDB entries) Uniprot Q65YW7 |
![]() | Domain d1vfsb2: 1vfs B:1013-1249 [108587] Other proteins in same PDB: d1vfsa1, d1vfsa3, d1vfsb1, d1vfsb3 complexed with cl, dcs |
PDB Entry: 1vfs (more details), 1.9 Å
SCOPe Domain Sequences for d1vfsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfsb2 c.1.6.1 (B:1013-1249) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]} dldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlgtatpeealel raagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagrtariqlkadt glgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirlqldafrdmla yaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpaqlglrpa
Timeline for d1vfsb2: