SCOP 1.69: Domain d1vfsb2: 1vfs B:1013-1249

Lineage for d1vfsb2 (1vfs B:1013-1249)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Alanine racemase [51421] (3 species)

7. Species Streptomyces lavendulae [TaxId:1914] [110346] (3 PDB entries)

8. Domain d1vfsb2: 1vfs B:1013-1249 [108587]
   Other proteins in same PDB: d1vfsa1, d1vfsb1

Details for d1vfsb2

PDB Entry: 1vfs, 1.9 Å

PDB Description: Crystal structure of D-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae

SCOP Domain Sequences for d1vfsb2:

Sequence; same for both SEQRES and ATOM records:

>d1vfsb2 c.1.6.1 (B:1013-1249) Alanine racemase {Streptomyces lavendulae}
dldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlgtatpeealel
raagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagrtariqlkadt
glgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirlqldafrdmla
yaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpaqlglrpa

Timeline for d1vfsb2:

• d1vfsb2 is new in SCOP 1.69
  
• d1vfsb2 appears in SCOP 1.71
  
• d1vfsb2 appears in the current release, SCOPe 2.08