Lineage for d1vfsa2 (1vfs A:13-249)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437734Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2437735Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2437736Protein Alanine racemase [51421] (3 species)
  7. 2437756Species Streptomyces lavendulae [TaxId:1914] [110346] (3 PDB entries)
    Uniprot Q65YW7
  8. 2437757Domain d1vfsa2: 1vfs A:13-249 [108585]
    Other proteins in same PDB: d1vfsa1, d1vfsa3, d1vfsb1, d1vfsb3
    complexed with cl, dcs

Details for d1vfsa2

PDB Entry: 1vfs (more details), 1.9 Å

PDB Description: Crystal structure of D-cycloserine-bound form of alanine racemase from D-cycloserine-producing Streptomyces lavendulae
PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1vfsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfsa2 c.1.6.1 (A:13-249) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}
dldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlgtatpeealel
raagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagrtariqlkadt
glgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirlqldafrdmla
yaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpaqlglrpa

SCOPe Domain Coordinates for d1vfsa2:

Click to download the PDB-style file with coordinates for d1vfsa2.
(The format of our PDB-style files is described here.)

Timeline for d1vfsa2: