![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
![]() | Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) |
![]() | Protein Alanine racemase [50623] (3 species) |
![]() | Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries) Uniprot Q65YW7 |
![]() | Domain d1vfsa1: 1vfs A:4-12,A:250-378 [108584] Other proteins in same PDB: d1vfsa2, d1vfsa3, d1vfsb2, d1vfsb3 complexed with cl, dcs |
PDB Entry: 1vfs (more details), 1.9 Å
SCOPe Domain Sequences for d1vfsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfsa1 b.49.2.2 (A:4-12,A:250-378) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]} tptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnasg rgpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaahti ayeivtriggrvprvylgg
Timeline for d1vfsa1: