Lineage for d1vfha2 (1vfh A:13-249)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1144857Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 1144858Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 1144859Protein Alanine racemase [51421] (3 species)
  7. 1144879Species Streptomyces lavendulae [TaxId:1914] [110346] (3 PDB entries)
    Uniprot Q65YW7
  8. 1144882Domain d1vfha2: 1vfh A:13-249 [108575]
    Other proteins in same PDB: d1vfha1
    complexed with plp

Details for d1vfha2

PDB Entry: 1vfh (more details), 2 Å

PDB Description: Crystal structure of alanine racemase from D-cycloserine producing Streptomyces lavendulae
PDB Compounds: (A:) alanine racemase

SCOPe Domain Sequences for d1vfha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfha2 c.1.6.1 (A:13-249) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}
dldavranvralraraprsalmavvksnayghgavpcaraaqeagaawlgtatpeealel
raagiqgrimcwlwtpggpwreaietdidvsvsgmwaldevraaaraagrtariqlkadt
glgrngcqpadwaelvgaavaaqaegtvqvtgvwshfacadepghpsirlqldafrdmla
yaekegvdpevrhianspatltlpethfdlvrtglavygvspspelgtpaqlglrpa

SCOPe Domain Coordinates for d1vfha2:

Click to download the PDB-style file with coordinates for d1vfha2.
(The format of our PDB-style files is described here.)

Timeline for d1vfha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vfha1