SCOP 1.71: Domain d1vfha1: 1vfh A:3-12,A:250-384

Lineage for d1vfha1 (1vfh A:3-12,A:250-384)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase [88682] (1 protein)

6. Protein Alanine racemase [50623] (3 species)

7. Species Streptomyces lavendulae [TaxId:1914] [110244] (3 PDB entries)

8. Domain d1vfha1: 1vfh A:3-12,A:250-384 [108574]
   Other proteins in same PDB: d1vfha2
   complexed with plp

Details for d1vfha1

PDB Entry: 1vfh, 2 Å

PDB Description: Crystal structure of alanine racemase from D-cycloserine producing Streptomyces lavendulae

SCOP Domain Sequences for d1vfha1:

Sequence; same for both SEQRES and ATOM records:

>d1vfha1 b.49.2.2 (A:3-12,A:250-384) Alanine racemase {Streptomyces lavendulae}
etptrvyaeiXmtlraslalvktvpaghgvsyghhyvtesethlalvpagyadgiprnas
grgpvlvagkirraagriamdqfvvdlgedlaeagdeavilgdaergeptaedwaqaaht
iayeivtriggrvprvylgglehhhh

Timeline for d1vfha1:

• d1vfha1 first appeared in SCOP 1.69
  
• d1vfha1 appears in SCOP 1.73
  
• d1vfha1 appears in the current release, SCOPe 2.08