SCOPe 2.07: Domain d1veub1: 1veu B:1-123

Lineage for d1veub1 (1veu B:1-123)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Late endosomal/lysosomal Mp1 interacting protein p14 [111123] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111124] (5 PDB entries)
   Uniprot Q9JHS3

8. Domain d1veub1: 1veu B:1-123 [108556]
   Other proteins in same PDB: d1veua_, d1veub2

Details for d1veub1

PDB Entry: 1veu, 2.15 Å

PDB Description: Crystal structure of the p14/MP1 complex at 2.15 A resolution

PDB Compounds: (B:) Late endosomal/lysosomal Mp1 interacting protein

SCOPe Domain Sequences for d1veub1:

Sequence; same for both SEQRES and ATOM records:

>d1veub1 d.110.7.1 (B:1-123) Late endosomal/lysosomal Mp1 interacting protein p14 {Mouse (Mus musculus) [TaxId: 10090]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnedslkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
qva

Timeline for d1veub1:

• d1veub1 first appeared in SCOP 1.69, called d1veub_
  
• d1veub1 appears in SCOPe 2.06
  
• d1veub1 appears in the current release, SCOPe 2.08