Lineage for d1veta_ (1vet A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577625Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2577626Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2577649Protein MEK binding partner 1, MP1 [111120] (2 species)
    remote homolog that forms the characteristic complex structures with other members
  7. 2577654Species Mouse (Mus musculus) [TaxId:10090] [111122] (2 PDB entries)
    Uniprot O88653
  8. 2577655Domain d1veta_: 1vet A: [108553]
    Other proteins in same PDB: d1vetb_

Details for d1veta_

PDB Entry: 1vet (more details), 1.9 Å

PDB Description: Crystal Structure of p14/MP1 at 1.9 A resolution
PDB Compounds: (A:) Mitogen-activated protein kinase kinase 1 interacting protein 1

SCOPe Domain Sequences for d1veta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veta_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Mouse (Mus musculus) [TaxId: 10090]}
addlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikvv
ev

SCOPe Domain Coordinates for d1veta_:

Click to download the PDB-style file with coordinates for d1veta_.
(The format of our PDB-style files is described here.)

Timeline for d1veta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vetb_