Lineage for d1vera_ (1ver A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 452460Protein Novel antigen receptor 12Y-1 [110044] (1 species)
  7. 452461Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [110045] (1 PDB entry)
  8. 452462Domain d1vera_: 1ver A: [108550]

Details for d1vera_

PDB Entry: 1ver (more details), 2.82 Å

PDB Description: Structure of New Antigen Receptor variable domain from sharks

SCOP Domain Sequences for d1vera_:

Sequence, based on SEQRES records: (download)

>d1vera_ b.1.1.1 (A:) Novel antigen receptor 12Y-1 {Spotted wobbegong (Orectolobus maculatus)}
awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
kgsksfslrirdlrvedsgtykcgafrfwlpygygslplsekgagtvltvk

Sequence, based on observed residues (ATOM records): (download)

>d1vera_ b.1.1.1 (A:) Novel antigen receptor 12Y-1 {Spotted wobbegong (Orectolobus maculatus)}
awvdqtprtatketgesltincvlrdasyglestgwyrtklgstneqtisiggryvetvn
kgsksfslrirdlrvedsgtykcgafrlsekgagtvltvk

SCOP Domain Coordinates for d1vera_:

Click to download the PDB-style file with coordinates for d1vera_.
(The format of our PDB-style files is described here.)

Timeline for d1vera_: