Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Mycobacterium smegmatis [TaxId:1772] [109784] (4 PDB entries) |
Domain d1veql_: 1veq L: [108549] complexed with fe |
PDB Entry: 1veq (more details), 3.98 Å
SCOP Domain Sequences for d1veql_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veql_ a.25.1.1 (L:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk siekledldlvsqdlliahagelekfqwfvrahlesag
Timeline for d1veql_: