Lineage for d1veqd_ (1veq D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766465Species Mycobacterium smegmatis [TaxId:1772] [109784] (6 PDB entries)
    Uniprot Q8VP75
  8. 766493Domain d1veqd_: 1veq D: [108541]

Details for d1veqd_

PDB Entry: 1veq (more details), 3.98 Å

PDB Description: Mycobacterium smegmatis Dps Hexagonal form
PDB Compounds: (D:) starvation-induced DNA protecting protein

SCOP Domain Sequences for d1veqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veqd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesag

SCOP Domain Coordinates for d1veqd_:

Click to download the PDB-style file with coordinates for d1veqd_.
(The format of our PDB-style files is described here.)

Timeline for d1veqd_: