Class a: All alpha proteins [46456] (226 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (7 proteins) |
Protein Dodecameric ferritin homolog [47250] (10 species) |
Species Mycobacterium smegmatis [TaxId:1772] [109784] (3 PDB entries) |
Domain d1velc_: 1vel C: [108534] |
PDB Entry: 1vel (more details), 2.99 Å
SCOP Domain Sequences for d1velc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1velc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Mycobacterium smegmatis} sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk siekledldlvsqdlliahagelekfqwfvrahlesaggqlthegq
Timeline for d1velc_: