Lineage for d1velb_ (1vel B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484862Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1485061Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 1485066Domain d1velb_: 1vel B: [108533]
    complexed with cd, na, so4

Details for d1velb_

PDB Entry: 1vel (more details), 2.99 Å

PDB Description: Mycobacterium smegmatis Dps tetragonal form
PDB Compounds: (B:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1velb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1velb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesaggqlth

SCOPe Domain Coordinates for d1velb_:

Click to download the PDB-style file with coordinates for d1velb_.
(The format of our PDB-style files is described here.)

Timeline for d1velb_: