SCOPe 2.07: Domain d1vcwc2: 1vcw C:42-254

Lineage for d1vcwc2 (1vcw C:42-254)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d1vcwc2: 1vcw C:42-254 [108515]
   Other proteins in same PDB: d1vcwa1, d1vcwb1, d1vcwc1

Details for d1vcwc2

PDB Entry: 1vcw, 3.05 Å

PDB Description: Crystal structure of DegS after backsoaking the activating peptide

PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d1vcwc2:

Sequence; same for both SEQRES and ATOM records:

>d1vcwc2 b.47.1.1 (C:42-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklirdgrv

Timeline for d1vcwc2:

• d1vcwc2 first appeared in SCOP 1.69
  
• d1vcwc2 appears in SCOPe 2.06
  
• d1vcwc2 appears in the current release, SCOPe 2.08