Lineage for d1vbza_ (1vbz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603934Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 603935Family d.58.7.1: Canonical RBD [54929] (32 proteins)
  6. 604092Protein Splicesomal U1A protein [54932] (1 species)
    duplication: contains two domains of this fold
  7. 604093Species Human (Homo sapiens) [TaxId:9606] [54933] (24 PDB entries)
  8. 604119Domain d1vbza_: 1vbz A: [108491]
    complexed with ba; mutant

Details for d1vbza_

PDB Entry: 1vbz (more details), 2.8 Å

PDB Description: Crystal Structure of the Hepatitis Delta Virus Gemonic Ribozyme Precursor, with C75U mutaion, in Ba2+ solution

SCOP Domain Sequences for d1vbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbza_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOP Domain Coordinates for d1vbza_:

Click to download the PDB-style file with coordinates for d1vbza_.
(The format of our PDB-style files is described here.)

Timeline for d1vbza_: