SCOPe 2.07: Domain d1v9ka_: 1v9k A:

Lineage for d1v9ka_ (1v9k A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal large subunit pseudouridine synthase C, RluC [111010] (1 species)

7. Species Escherichia coli [TaxId:562] [111011] (1 PDB entry)
   Uniprot P23851

8. Domain d1v9ka_: 1v9k A: [108449]
   complexed with so4

Details for d1v9ka_

PDB Entry: 1v9k, 2 Å

PDB Description: the crystal structure of the catalytic domain of pseudouridine synthase rluc from escherichia coli

PDB Compounds: (A:) Ribosomal large subunit pseudouridine synthase C

SCOPe Domain Sequences for d1v9ka_:

Sequence; same for both SEQRES and ATOM records:

>d1v9ka_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase C, RluC {Escherichia coli [TaxId: 562]}
dvimyeddhilvlnkpsgtavhggsglsfgvieglralrpearflelvhrldrdtsgvll
vakkrsalrslheqlrekgmqkdylalvrgqwqshvksvqapllknilqsgerivrvsqe
gkpsetrfkveeryafatlvrcspvtgrthqirvhtqyaghpiafddrygdrefdrqlte
agtglnrlflhaaalkfthpgtgevmrieapmdeglkrclqkmrnar

Timeline for d1v9ka_:

• d1v9ka_ first appeared in SCOP 1.69
  
• d1v9ka_ appears in SCOPe 2.06
  
• d1v9ka_ appears in the current release, SCOPe 2.08