Lineage for d1v9fa_ (1v9f A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052430Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1052431Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 1052471Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 1052476Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species)
  7. 1052477Species Escherichia coli [TaxId:562] [103020] (3 PDB entries)
    Uniprot P33643
  8. 1052478Domain d1v9fa_: 1v9f A: [108448]
    complexed with po4

Details for d1v9fa_

PDB Entry: 1v9f (more details), 1.7 Å

PDB Description: Crystal structure of catalytic domain of pseudouridine synthase RluD from Escherichia coli
PDB Compounds: (A:) Ribosomal large subunit pseudouridine synthase D

SCOPe Domain Sequences for d1v9fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9fa_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]}
fepqdipldivyedediiiinkprdlvvhpgagnpdgtvlnallhyyppiadvpragivh
rldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkr
thmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggr
prppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmradf
eehkdevdwl

SCOPe Domain Coordinates for d1v9fa_:

Click to download the PDB-style file with coordinates for d1v9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1v9fa_: