Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins) contains N-terminal alpha-L RNA-binding motif |
Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species) |
Species Escherichia coli [TaxId:562] [103020] (3 PDB entries) Uniprot P33643 |
Domain d1v9fa_: 1v9f A: [108448] complexed with po4 |
PDB Entry: 1v9f (more details), 1.7 Å
SCOP Domain Sequences for d1v9fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9fa_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]} fepqdipldivyedediiiinkprdlvvhpgagnpdgtvlnallhyyppiadvpragivh rldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhptkr thmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyggr prppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmradf eehkdevdwl
Timeline for d1v9fa_: