Lineage for d1v8qc_ (1v8q C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810963Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 810964Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 810965Protein Ribosomal protein L27 [110326] (3 species)
  7. 811008Species Thermus thermophilus [TaxId:274] [110327] (2 PDB entries)
    Uniprot P84123
  8. 811011Domain d1v8qc_: 1v8q C: [108430]
    Structural genomics target

Details for d1v8qc_

PDB Entry: 1v8q (more details), 2.8 Å

PDB Description: Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8
PDB Compounds: (C:) tt0826

SCOP Domain Sequences for d1v8qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8qc_ b.84.4.1 (C:) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]}
rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
hvrpla

SCOP Domain Coordinates for d1v8qc_:

Click to download the PDB-style file with coordinates for d1v8qc_.
(The format of our PDB-style files is described here.)

Timeline for d1v8qc_: