Lineage for d1v89a_ (1v89 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467456Protein Rho-GTPase-activating protein 25 (KIAA0053) [110268] (1 species)
  7. 467457Species Human (Homo sapiens) [TaxId:9606] [110269] (1 PDB entry)
  8. 467458Domain d1v89a_: 1v89 A: [108424]
    Structural genomics target

Details for d1v89a_

PDB Entry: 1v89 (more details)

PDB Description: solution structure of the pleckstrin homology domain of human kiaa0053 protein

SCOP Domain Sequences for d1v89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens)}
gssgssgpikmgwlkkqrsivknwqqryfvlraqqlyyykdeedtkpqgcmylpgctike
iatnpeeagkfvfeiipaswdqnrmgqdsyvlmassqaemeewvkflrrvagsgpssg

SCOP Domain Coordinates for d1v89a_:

Click to download the PDB-style file with coordinates for d1v89a_.
(The format of our PDB-style files is described here.)

Timeline for d1v89a_: