Lineage for d1v5ta_ (1v5t A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637463Protein 8430435i17rik protein [110798] (1 species)
  7. 1637464Species Mouse (Mus musculus) [TaxId:10090] [110799] (1 PDB entry)
    Uniprot Q8BGR9 3-79
  8. 1637465Domain d1v5ta_: 1v5t A: [108385]
    Structural genomics target

Details for d1v5ta_

PDB Entry: 1v5t (more details)

PDB Description: solution structure of the ubiquitin-like domain from mouse hypothetical 8430435i17rik protein
PDB Compounds: (A:) 8430435I17Rik Protein

SCOPe Domain Sequences for d1v5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssglpiivkwggqeysvttlseddtvldlkqflktltgvlperqkllglkvkgkpa
endvklgalklkpntkimmmgtresgpssg

SCOPe Domain Coordinates for d1v5ta_:

Click to download the PDB-style file with coordinates for d1v5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ta_: