Lineage for d1v5sa_ (1v5s A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872976Superfamily d.129.6: KA1-like [103243] (2 families) (S)
    contains a single copy of this fold
  5. 872977Family d.129.6.1: Kinase associated domain 1, KA1 [103244] (1 protein)
    Pfam PF02149
  6. 872978Protein Map/microtubule affinity-regulating kinase 3 [103245] (1 species)
  7. 872979Species Mouse (Mus musculus) [TaxId:10090] [103246] (2 PDB entries)
    Uniprot Q8C6G9 373-452
  8. 872981Domain d1v5sa_: 1v5s A: [108384]
    Structural genomics target

Details for d1v5sa_

PDB Entry: 1v5s (more details)

PDB Description: solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
PDB Compounds: (A:) MAP/microtubule affinity-regulating kinase 3

SCOP Domain Sequences for d1v5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5sa_ d.129.6.1 (A:) Map/microtubule affinity-regulating kinase 3 {Mouse (Mus musculus) [TaxId: 10090]}
mkdhlihnvhkeehahahnkdydipttenlyfqgssgssgdmmreirkvlganncdyeqr
erfllfcvhgdghaenlvqwemevcklprlslngvrfkrisgtsiafkniaskianelkl
sgpssg

SCOP Domain Coordinates for d1v5sa_:

Click to download the PDB-style file with coordinates for d1v5sa_.
(The format of our PDB-style files is described here.)

Timeline for d1v5sa_: