SCOP 1.69: Domain d1v5na_: 1v5n A:

Lineage for d1v5na_ (1v5n A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (3 families)

5. Family g.49.1.3: C1-like domain (Pfam 07649; Pfam 03107) [111463] (1 protein)

6. Protein Pdi-like hypothetical protein At1g60420 [111464] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111465] (1 PDB entry)

8. Domain d1v5na_: 1v5n A: [108380]
   Structural genomics target

Details for d1v5na_

PDB Entry: 1v5n

PDB Description: solution structure of dc1 domain of pdi-like hypothetical protein from arabidopsis thaliana

SCOP Domain Sequences for d1v5na_:

Sequence; same for both SEQRES and ATOM records:

>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana)}
gssgssgteerlkeieakydeiakdwpkkvkhvlheeheleltrvqvytcdkceeegtiw
syhcdecdfdlhakcalnedtkesgpssg

Timeline for d1v5na_:

• d1v5na_ is new in SCOP 1.69
  
• d1v5na_ appears in SCOP 1.71
  
• d1v5na_ appears in the current release, SCOPe 2.08, called d1v5na1