Lineage for d1v5ma_ (1v5m A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467462Protein SH2 and PH domain-containing adapter protein APS [110256] (1 species)
  7. 467463Species Mouse (Mus musculus) [TaxId:10090] [110257] (1 PDB entry)
  8. 467464Domain d1v5ma_: 1v5m A: [108379]
    Structural genomics target

Details for d1v5ma_

PDB Entry: 1v5m (more details)

PDB Description: solution structure of the pleckstrin homology domain of mouse aps

SCOP Domain Sequences for d1v5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus)}
gssgssgnlaakvelvdiqregalrfmvaddaasgpggtaqwqkcrlllrravagerfrl
effvppkasrpkvsiplsaiievrttmplempekdntfvlkvengaeyiletidslqkhs
wvadiqgcvdsgpssg

SCOP Domain Coordinates for d1v5ma_:

Click to download the PDB-style file with coordinates for d1v5ma_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ma_: