SCOP 1.75: Domain d1v4ub_: 1v4u B:

Lineage for d1v4ub_ (1v4u B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
   Uniprot Q8AYM1

8. Domain d1v4ub_: 1v4u B: [108356]
   Other proteins in same PDB: d1v4ua_, d1v4uc_

Details for d1v4ub_

PDB Entry: 1v4u, 2 Å

PDB Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin

PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1v4ub_:

Sequence; same for both SEQRES and ATOM records:

>d1v4ub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalg

Timeline for d1v4ub_:

• d1v4ub_ first appeared in SCOP 1.69
  
• d1v4ub_ appears in SCOP 1.73
  
• d1v4ub_ appears in SCOPe 2.01
  
• d1v4ub_ appears in the current release, SCOPe 2.08