SCOPe 2.08: Domain d1v3vb1: 1v3v B:2-112,B:295-329

Lineage for d1v3vb1 (1v3v B:2-112,B:295-329)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species)

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (4 PDB entries)
   Uniprot Q9EQZ5

8. Domain d1v3vb1: 1v3v B:2-112,B:295-329 [108347]
   Other proteins in same PDB: d1v3va2, d1v3va3, d1v3vb2
   complexed with 5op, cl, nap

Details for d1v3vb1

PDB Entry: 1v3v, 2 Å

PDB Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complexed with NADP and 15-oxo-PGE2

PDB Compounds: (B:) leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase

SCOPe Domain Sequences for d1v3vb1:

Sequence; same for both SEQRES and ATOM records:

>d1v3vb1 b.35.1.2 (B:2-112,B:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkega
vmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyhehv
tkgfenmpaafiemlnganlgkavvta

Timeline for d1v3vb1:

• d1v3vb1 first appeared in SCOP 1.69
  
• d1v3vb1 appears in SCOPe 2.07