SCOP 1.69: Domain d1v3lb3: 1v3l B:407-496

Lineage for d1v3lb3 (1v3l B:407-496)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)

8. Domain d1v3lb3: 1v3l B:407-496 [108327]
   Other proteins in same PDB: d1v3la1, d1v3la2, d1v3la4, d1v3lb1, d1v3lb2, d1v3lb4

Details for d1v3lb3

PDB Entry: 1v3l, 2.1 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose

SCOP Domain Sequences for d1v3lb3:

Sequence; same for both SEQRES and ATOM records:

>d1v3lb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

Timeline for d1v3lb3:

• d1v3lb3 is new in SCOP 1.69
  
• d1v3lb3 appears in SCOP 1.71
  
• d1v3lb3 appears in the current release, SCOPe 2.08