![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries) |
![]() | Domain d1v3la2: 1v3l A:583-686 [108322] Other proteins in same PDB: d1v3la1, d1v3la3, d1v3la4, d1v3lb1, d1v3lb3, d1v3lb4 |
PDB Entry: 1v3l (more details), 2.1 Å
SCOP Domain Sequences for d1v3la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3la2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011} tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1v3la2:
![]() Domains from other chains: (mouse over for more information) d1v3lb1, d1v3lb2, d1v3lb3, d1v3lb4 |