Lineage for d1v3la1 (1v3l A:497-582)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770292Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1770338Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 1770380Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries)
    Uniprot P05618
  8. 1770395Domain d1v3la1: 1v3l A:497-582 [108321]
    Other proteins in same PDB: d1v3la2, d1v3la3, d1v3la4, d1v3lb2, d1v3lb3, d1v3lb4
    complexed with ca; mutant

Details for d1v3la1

PDB Entry: 1v3l (more details), 2.1 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase complexed with a pseudo-tetraose derived from acarbose
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3la1 b.1.18.2 (A:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011 [TaxId: 1409]}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOPe Domain Coordinates for d1v3la1:

Click to download the PDB-style file with coordinates for d1v3la1.
(The format of our PDB-style files is described here.)

Timeline for d1v3la1: