Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries) |
Domain d1v3kb1: 1v3k B:497-582 [108317] Other proteins in same PDB: d1v3ka2, d1v3ka3, d1v3ka4, d1v3kb2, d1v3kb3, d1v3kb4 complexed with ca; mutant |
PDB Entry: 1v3k (more details), 2 Å
SCOP Domain Sequences for d1v3kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3kb1 b.1.18.2 (B:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011} ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav pggiydirvanaagaasniydnfevl
Timeline for d1v3kb1:
View in 3D Domains from other chains: (mouse over for more information) d1v3ka1, d1v3ka2, d1v3ka3, d1v3ka4 |