Lineage for d1v3ka3 (1v3k A:407-496)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328053Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 1328095Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
    Uniprot P05618
  8. 1328100Domain d1v3ka3: 1v3k A:407-496 [108315]
    Other proteins in same PDB: d1v3ka1, d1v3ka2, d1v3ka4, d1v3kb1, d1v3kb2, d1v3kb4
    complexed with ca; mutant

Details for d1v3ka3

PDB Entry: 1v3k (more details), 2 Å

PDB Description: crystal structure of f283y mutant cyclodextrin glycosyltransferase
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3ka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ka3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOPe Domain Coordinates for d1v3ka3:

Click to download the PDB-style file with coordinates for d1v3ka3.
(The format of our PDB-style files is described here.)

Timeline for d1v3ka3: