SCOPe 2.03: Domain d1v3jb4: 1v3j B:1-406

Lineage for d1v3jb4 (1v3j B:1-406)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

Protein Cyclodextrin glycosyltransferase [51452] (5 species)
contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries)
Uniprot P05618
Domain d1v3jb4: 1v3j B:1-406 [108312]
Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja3, d1v3jb1, d1v3jb2, d1v3jb3
complexed with ca; mutant

Details for d1v3jb4

PDB Entry: 1v3j (more details), 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase

PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3jb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3jb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOPe Domain Coordinates for d1v3jb4:

Click to download the PDB-style file with coordinates for d1v3jb4.
(The format of our PDB-style files is described here.)

Timeline for d1v3jb4: