SCOPe 2.07: Domain d1v3ja4: 1v3j A:1-406

Lineage for d1v3ja4 (1v3j A:1-406)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries)
   Uniprot P05618

8. Domain d1v3ja4: 1v3j A:1-406 [108308]
   Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja3, d1v3jb1, d1v3jb2, d1v3jb3
   complexed with ca; mutant

Details for d1v3ja4

PDB Entry: 1v3j, 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3ja4:

Sequence; same for both SEQRES and ATOM records:

>d1v3ja4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

Timeline for d1v3ja4:

• d1v3ja4 first appeared in SCOP 1.69
  
• d1v3ja4 appears in SCOPe 2.06
  
• d1v3ja4 appears in the current release, SCOPe 2.08