| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
| Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
| Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries) Uniprot P05618 |
| Domain d1v3ja4: 1v3j A:1-406 [108308] Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja3, d1v3jb1, d1v3jb2, d1v3jb3 complexed with ca; mutant |
PDB Entry: 1v3j (more details), 2 Å
SCOPe Domain Sequences for d1v3ja4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3ja4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay
Timeline for d1v3ja4:
View in 3DDomains from other chains: (mouse over for more information) d1v3jb1, d1v3jb2, d1v3jb3, d1v3jb4 |