Lineage for d1v3ja4 (1v3j A:1-406)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474053Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 474230Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 474231Species Alkalophilic bacillus sp., strain 1011 [51456] (8 PDB entries)
  8. 474242Domain d1v3ja4: 1v3j A:1-406 [108308]
    Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja3, d1v3jb1, d1v3jb2, d1v3jb3

Details for d1v3ja4

PDB Entry: 1v3j (more details), 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1v3ja4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ja4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1v3ja4:

Click to download the PDB-style file with coordinates for d1v3ja4.
(The format of our PDB-style files is described here.)

Timeline for d1v3ja4: