Lineage for d1v3ja2 (1v3j A:583-686)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790368Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 790404Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
    this domain is the last one in the protein chain
  7. 790446Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries)
    Uniprot P05618
  8. 790457Domain d1v3ja2: 1v3j A:583-686 [108306]
    Other proteins in same PDB: d1v3ja1, d1v3ja3, d1v3ja4, d1v3jb1, d1v3jb3, d1v3jb4

Details for d1v3ja2

PDB Entry: 1v3j (more details), 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d1v3ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ja2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOP Domain Coordinates for d1v3ja2:

Click to download the PDB-style file with coordinates for d1v3ja2.
(The format of our PDB-style files is described here.)

Timeline for d1v3ja2: