| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
| Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries) Uniprot P05618 |
| Domain d1v3ja1: 1v3j A:497-582 [108305] Other proteins in same PDB: d1v3ja2, d1v3ja3, d1v3ja4, d1v3jb2, d1v3jb3, d1v3jb4 complexed with ca; mutant |
PDB Entry: 1v3j (more details), 2 Å
SCOPe Domain Sequences for d1v3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3ja1 b.1.18.2 (A:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011 [TaxId: 1409]}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl
Timeline for d1v3ja1:
View in 3DDomains from other chains: (mouse over for more information) d1v3jb1, d1v3jb2, d1v3jb3, d1v3jb4 |