Lineage for d1v3ia_ (1v3i A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438707Protein beta-Amylase [51481] (3 species)
    Common fold covers whole protein structure
  7. 2438710Species Soybean (Glycine max) [TaxId:3847] [51482] (18 PDB entries)
    Uniprot P10538
  8. 2438715Domain d1v3ia_: 1v3i A: [108304]
    complexed with so4

Details for d1v3ia_

PDB Entry: 1v3i (more details), 1.9 Å

PDB Description: the roles of glu186 and glu380 in the catalytic reaction of soybean beta-amylase
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1v3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ia_ c.1.8.1 (A:) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]}
nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
vlsggwredirvagqnalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
lpetdmkvdg

SCOPe Domain Coordinates for d1v3ia_:

Click to download the PDB-style file with coordinates for d1v3ia_.
(The format of our PDB-style files is described here.)

Timeline for d1v3ia_: