Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries) |
Domain d1v2rt_: 1v2r T: [108294] complexed with anh, ca, so4; mutant |
PDB Entry: 1v2r (more details), 1.7 Å
SCOP Domain Sequences for d1v2rt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v2rt_ b.47.1.2 (T:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksassriitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1v2rt_: