Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110810] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [110811] (2 PDB entries) |
Domain d1v1ob2: 1v1o B:109-213 [108267] Other proteins in same PDB: d1v1oa1, d1v1ob1 |
PDB Entry: 1v1o (more details), 2.75 Å
SCOP Domain Sequences for d1v1ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1ob2 d.15.6.1 (B:109-213) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus} nktsetntplfvnkvngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtsky gkiiinlkdenkveidlgdklqfermgdvlnskdirgisvtinqi
Timeline for d1v1ob2: