Lineage for d1v1ob2 (1v1o B:109-213)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599052Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 599053Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 599054Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110810] (1 species)
  7. 599055Species Staphylococcus aureus [TaxId:1280] [110811] (2 PDB entries)
  8. 599057Domain d1v1ob2: 1v1o B:109-213 [108267]
    Other proteins in same PDB: d1v1oa1, d1v1ob1

Details for d1v1ob2

PDB Entry: 1v1o (more details), 2.75 Å

PDB Description: staphylococcal superantigen-like protein 7

SCOP Domain Sequences for d1v1ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1ob2 d.15.6.1 (B:109-213) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus}
nktsetntplfvnkvngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtsky
gkiiinlkdenkveidlgdklqfermgdvlnskdirgisvtinqi

SCOP Domain Coordinates for d1v1ob2:

Click to download the PDB-style file with coordinates for d1v1ob2.
(The format of our PDB-style files is described here.)

Timeline for d1v1ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v1ob1